4359 products were found matching your search for Age Smart Super Rich in 7 shops:

Age Smart Super Rich Repair Moisturizer 50mL

Smart Clinical Repair Wrinkle Correcting Rich Cream 50mL

Samsung's Bespoke Ultra Capacity Gas Dryer has a sleek, flat-panel design, comes in new premium colors, and is equipped with smart features that simplify your laundry experience. Plus, automatic alerts let you know when it's time to clean your air duct or check for obstructions so performance stays at its peak. It has our Super Speed Dry, which optimally dries a full load in just 30-minutes, and our AI Smart Dial, which learns and recommends your favorite cycles and makes controlling your dryer a breeze. Color: Brushed Black.

Samsung's Bespoke Ultra Capacity Electric Dryer has a sleek, flat-panel design, comes in new premium colors, and is equipped with smart features that simplify your laundry experience. It has our AI Optimal Dry, which automatically chooses the best settings based on what you're drying, to take the guesswork out of cycle selection, and Super Speed Dry, which optimally dries a full load in just 30-minutes. A shallower depth allows for easy closet installation without sacrificing capacity. Color: Brushed Navy.

Samsung's Bespoke Ultra Capacity Electric Dryer has a sleek, flat-panel design, comes in new premium colors, and is equipped with smart features that simplify your laundry experience. It has our AI Optimal Dry, which automatically chooses the best settings based on what you're drying, to take the guesswork out of cycle selection, and Super Speed Dry, which optimally dries a full load in just 30-minutes. A shallower depth allows for easy closet installation without sacrificing capacity. Color: Forest Green.

Age Smart Phyto Nature Firming Serum 40mL

Age Smart Multivitamin Power Firm 15mL

Age Smart Antioxidant Hydramist 30mL

Age Smart Age Reversal Eye Complex 15mL

Age Smart Skinperfect Primer 22mL SPF30

Age Smart Dynamic Skin Recovery 50mL SPF50

Wrinkle-fighting cream helps strengthen and nourish for smoother, younger-looking skin. Dermatologist tested. Safe for sensitive skin. Allergy tested. 100% fragrance free. Clinique Smart Clinical Repair & trade; Wrinkle Correcting Rich Cream - 1.7oz/50ml

The Samsung 5.2 cu. ft. Large Capacity Top Load Washing Machine is equipped with Super Speed Wash, which powerfully cleans a full load of laundry in just 28 minutes without sacrificing cleaning performance.*This Wi-Fi connected machine lets you start, stop, or delay your smart washer from our simple-to-use SmartThings app.** Purchase with confidence with a 20-year warranty on the Digital Inverter Motor.****Based on using Super Speed on a Normal Cycle with an 8lb load.**Available on Android and iOS devices. A Wi-Fi connection and a Samsung account are required.***20-year warranty limited to the Digital Inverter Motor purchased on 7/1/2022 or later. Purchase receipt indicating purchase date required for a claim. Additional restrictions and limitations apply, see warranty for details. Color: Black.

Clinique Smart Clinical Repair Wrinkle Correcting Rich Face Cream - CLMRTCLCLRPRWRKLCRCTGCRMVRYDRYTDR 4.33OZBenefitsStrengthens, visibly repairs lines and wrinkles, hydratesA powerful addition to Clinique's most advanced de-aging line yet, Clinique Smart Clinical Repair, this ultra-nourishing moisturizer is engineered to visibly reduce lines and wrinkles for supple, younger-looking skin.Cutting-edge formula with CL1870 Peptide Complex helps boost skin's natural collagen to help fortify the dermal structure, leaving skin feeling stronger and looking smoother.Moisturizer plumps skin with lasting hydration.Available in two textures: Wrinkle Correcting Cream is a lightweight cream for All Skin Types and Wrinkle Correcting Rich Cream is a luxe, denser cream for those with drier skin.Built on Dermatological Science: As a dermatologist-guided brand, Clinique's commitment to safety starts with skincare science. Clinique partners with the best minds in dermatology and formulate for all skin types, tones, concerns - in service of all skin.Fragrance-free, Paraben-free, Phthalate-free, Oil-free, Free of synthetic colors.More Responsible Packaging:50ml and 15ml jars each contain a minimum of 30% post-consumer recycled content.Carton is made from responsibly sourced paperboard. Please recycle.Key IngredientsFormulated with peptides to help boost skin's strength for a smoother appearance and hyaluronic acid to help hydrate skin.CL1870 Peptide Complex: An expert peptide blend engineered to fight the look of wrinkles by boosting natural collagen, which helps strengthen skin's natural support structure.Hyaluronic acid: Exclusive formula uses two molecular weights of hyaluronic acid. This intense humectant helps flood your skin with hydration -and holds on. Helps restore suppleness and visibly smooth fine, dry lines.Soybean seed extract: An ingredient rich in lysophosphatidic acid (LPA), which nourishes to help fortify skin.Shea butter: Found in the Rich Cream, it contains lipids that form skin's barrier and is integral to keeping drier skin hydrated. - Clinique Smart Clinical Repair Wrinkle Correcting Rich Face Cream

Age Smart Dynamic Skin Recovery 15mL SPF50

Samsung's Bespoke Ultra Capacity Gas Dryer has a sleek, flat-panel design, comes in new premium colors, and is equipped with smart features that simplify your laundry experience. Plus, automatic alerts let you know when it's time to clean your air duct or check for obstructions so performance stays at its peak. It has our Super Speed Dry, which optimally dries a full load in just 30-minutes, and our AI Smart Dial, which learns and recommends your favorite cycles and makes controlling your dryer a breeze. Color: Silver Steel.

Samsung's Bespoke Ultra Capacity Electric Dryer has a sleek, flat-panel design, comes in new premium colors, and is equipped with smart features that simplify your laundry experience. It is eco-friendly and energy efficient. It has our Super Speed Dry, which optimally dries a full load in just 30-minutes, and our AI Smart Dial, which learns and recommends your favorite cycles and makes controlling your dryer a breeze. Color: Brushed Black.

Samsung's new 4.5 cu. ft. large capacity Front Load Washer features Super Speed Wash. Wash full loads with full performance in just 28 minutes. Built-in Wi-Fi so you can receive end of cycle alerts and remotely start, stop, and schedule laundry right from your smartphone.². Color: Platinum.

Anti-Age Anti-Wrinkle Rich Day Cream 50mL

Anti-Age Anti-Wrinkle Rich Night Cream 50mL